Cookie Policy

This website uses Cookies and similar technologies in order to distinguish you from other users. By using Cookies, We are able to provide you with a better experience and to improve Our Site by better understanding how you use it. Please read this Cookie Policy carefully and ensure that you understand it. Your acceptance of Our Cookie Policy is deemed to occur when you press the “accept” button on Our Cookie banner or when you have selected your preferred Cookie options in Our Cookie manager and pressed the “Continue” button. If you do not agree to Our Cookie Policy, please stop using Our Site immediately.

1. Definitions and Interpretation

In this Cookie Policy, unless the context otherwise requires, the following expressions have the following meanings:
Cookie: means a small file placed on your computer or device by Our Site when you visit certain parts of Our Site and/or when you use certain features of Our Site;
Cookie Law: means the relevant parts of the Privacy and Electronic Communications (EC Directive) Regulations 2003 and of EU Regulation 2016/679 General Data Protection Regulation (“GDPR”);
Personal data: means any and all data that relates to an identifiable person who can be directly or indirectly identified from that data, as defined by EU Regulation 2016/679 General Data Protection Regulation (“GDPR”); and
We/Us/Our: means “Our Website/School/Company”, the brand owned and operated by Company name or Person.

2. Information About Us

Our Site is owned and operated by Company name or person(s).
  • Registered address:
  • Email address:

3. How Does Our Site Use Cookies?

  • 3.1 Our Site may place and access certain first-party Cookies on your computer or device. First party Cookies are those placed directly by Us and are used only by Us. We use Cookies to facilitate and improve your experience of Our Site and services. We have carefully chosen these Cookies and have taken steps to ensure that your privacy and personal data is protected and respected at all times.
  • 3.2 By using Our Site, you may also receive certain third-party Cookies on your computer or device. Third-party Cookies are those placed by websites, services, and/or parties other than Us. Third-party Cookies are used on Our Site for analytics and for marketing purposes. For more details, please refer to section 4 below.
  • 3.3 All Cookies used by and on Our Site are used in accordance with current Cookie Law. We may use some or all of the following types of Cookie:
  • 3.3.1 Strictly Necessary Cookies
    A Cookie falls into this category (usually first-party cookies) if it is essential to the operation of Our Site as without them we cannot provide the functionality that you need to use this website. For example, essential cookies help remember your preferences as you navigate through the online school, also support functions such as logging in, and payment transactions.
  • 3.3.2 Functionality Cookies
    Functional Cookies allow our web site to remember choices you make, e.g. your user name, log in details and language preferences and any customizations you make to pages during your visit. They are necessary to provide features and services specific to individual users.
  • 3.3.3 Analytics Cookies
    It is important for Us to understand how you use Our Site, for example, how efficiently you are able to navigate around it, and what features you use. Analytics Cookies enable us to gather this information, helping Us to improve Our Site and your experience of it.
  • 3.3.4 Marketing/Targeting Cookies
    It is important for Us to know when and how often you visit Our Site, and which parts of it you have used (including which pages you have visited and which links you have visited). As with analytics Cookies, this information helps us to better understand you and, in turn, to make Our Site and advertising more relevant to your interests. Some information gathered by targeting Cookies may also be shared with third parties.
  • 3.3.5 Third Party Cookies
    Third-party Cookies are not placed by Us; instead, they are placed by third parties that provide services to Us and/or to you. Third-party Cookies may be used by advertising services to serve up tailored advertising to you on Our Site, or by third parties providing analytics services to Us (these Cookies will work in the same way as analytics Cookies described above).
  • 3.3.6 Persistent Cookies
    Any of the above types of Cookie may be a persistent Cookie. Persistent Cookies are those which remain on your computer or device for a predetermined period and are activated each time you visit Our Site.
  • 3.3.7 Session Cookies
    Any of the above types of Cookie may be a session Cookie. Session Cookies are temporary and only remain on your computer or device from the point at which you visit Our Site until you close your browser. Session Cookies are deleted when you close your browser.
  • 3.4 Cookies on Our Site are not permanent and will expire as indicated in the table below.
  • 3.5 For more details of the personal data that We collect and use, the measures we have in place to protect personal data, your legal rights, and our legal obligations, please refer to our Privacy Policy
  • 3.6 For more specific details of the Cookies that We use, please refer to the table below.

4. What Cookies Does Our Site Use?

  • 4.1 The following first-party Cookies may be placed on your computer or device:
Name of Cookie Purpose Strictly Necessary Expires
XSRF-TOKEN Preserves User Login information and states Yes When you close your browser
DPSettings Preserves the user's Cookie policy preferences Yes 12 days
slim_session Preserves User Login information and states Yes 1 day
  • 4.2 The following strictly necessary third-party Cookies may be placed on your computer or device (remove stripe cookies from the list if you don’t use stripe):
Name of Cookie Provider Purpose Expires
nsr Used to process payments for our website. When you close your browser
cookiesEnabled Used to process payments for our website. When you close your browser
__stripe_sid Used to process payments for our website. When you close your browser
__stripe_mid Used to distinguish users. 1 year
ab_disable_remember_ Used to process payments for our website. 7 years
checkout-test-session Used to process payments for our website. 10 years
cid Used to process payments for our website. for ever
vuid These cookies are used by Vimeo to collect analytics tracking information. 1 year
player These cookies are used by Vimeo to collect analytics tracking information. 1 year
  • 4.3 Our Site uses the following functional Cookies (remove cookies not exploited in your school):

Name of Cookie Provider Purpose Expires
hblidinsightleadershipacademy.coma visitor identifier that we use only on your site to remember this visitor between visits2 years
wcsidinsightleadershipacademy.coma session identifier that we use only on your site to keep track of a single chat sessionWhen you close your browser
olfskinsightleadershipacademy.comstorage identifier that we use to maintain chat state across pages (e.g. message history)2 years
_okbkinsightleadershipacademy.comextra state information (e.g. chat box being open/closed)When you close your browser
_okinsightleadershipacademy.commost recent Olark site ID (security measure)When you close your browser
_oklvinsightleadershipacademy.comthe Olark loader version (for improved caching)When you close your browser
_oklainsightleadershipacademy.comused for caching purposes (loaded from CDN vs. loaded from our infrastructure)When you close your browser
_okgidinsightleadershipacademy.comused for caching by setting a hash for assets to determine if they have changed and if they need to be refreshedWhen you close your browser
_okacinsightleadershipacademy.comused for caching by setting a hash for assets to determine if they have changed and if they need to be refreshedWhen you close your browser
Name of Cookie Provider PurposeExpires
TawkConnectionTime previous registration time stamp When you close your browser
Tawk_ socket connection url When you close your browser
__tawkuuid domain restriction values 6 months
__cfduid Used by the content network, Cloudflare, to identify trusted web traffic. 1 year
Name of Cookie Provider Purpose Expires
pubsub_cookie This cookie is used for the freshchat service When you close your browser
hop- This cookie is used for the freshchat service When you close your browser This cookie is used for the freshchat service When you close your browser
_ This cookie is used for the freshchat service 1 year
pnctest This cookie is used for the freshchat service 1 year
Zendesk Web Widget
Name of Cookie Provider Purpose Expires
ZD-referrerPolicy Stores referrer tags Forever
ZD-zE_oauth Stores the authentication token once the user has been authenticated. 2 hours
ZD-currentTime Sets the time when page loads. Forever
ZD-settings Stores a hash of settings so that we don't keep sending blips after the initial one Forever
ZD-suid Session id for pathfinder. 20 minutes
ZD-buid Collects Machine ID. Forever
Name of Cookie Provider Purpose Expires
intercom-id- This cookie is used by Intercom as a session so that users can continue a chat as they move through the site. 9 months
  • 4.4 Our Site uses analytics services provided by your analytics services, if any. Website analytics refers to a set of tools used to collect and analyse anonymous usage information, enabling us to better understand how Our Site is used. This, in turn, enables us to improve Our Site and the products and services offered through them.
  • 4.5 The analytics services used by Our Site use Cookies to gather the required information. You do not have to allow us to use these Cookies, however, whilst our use of them does not pose any risk to your privacy or your safe use of Our Site, it does enable us to continually improve Our Site, making it a better and more useful experience for you.
  • 4.6 The analytics services used by Our Site uses the following Cookies (remove cookies not exploited in your school)
Google Analytics
Name of Cookie Provider Purpose Expires
_ga Google Analytics: Registers a unique ID that is used to generate statistical data on how the visitor uses the website. 2 years
_gat Google Analytics: Used by Google Analytics to throttle the request rate. When you close your browser
_gid Google Analytics: Registers a unique ID that is used to generate statistical data on how the visitor uses the website. When you close your browser
collect Google Analytics: Used to send data to Google Analytics about the visitor's device and behaviour. Tracks the visitor across devices and marketing channels. When you close your browser
Name of Cookie Provider Purpose Expires
mp_#_mixpanel MixPanel: Cookie used by MixPanel for analytics purposes 1 year
Sumo me
Name of Cookie Provider Purpose Expires
__smToken The __smToken is set once you login to Sumo and is checked to verify whether you are logged into Sumo or not. 1 year
__smSmartbarShown Is set when the Smartbar is shown 50 years
__smVID Used to display relevant advertising 1 month
__smSessionId Used by Sumo to establish a cookie on a users computer to begin a session to enable Sumo products When you close your browser
  • 4.7 Targeting/Marketing cookies
    Targeting/Marketing cookies are used to track visitors across websites. They may be used by those companies to build a profile of your interests and show you relevant adverts on other sites. They do not store directly personal information but are based on uniquely identifying your browser and internet device. The intention is to display ads that are relevant and engaging for the individual user and thereby more valuable for publishers and third-party advertisers. If you do not allow these cookies, you will experience less targeted advertising (remove cookies not exploited in your school)
Name of Cookie Provider Purpose Expires
fr Used by Facebook to deliver a series of advertisement products such as real time bidding from third-party advertisers 3 months
fr Used by Facebook to deliver a series of advertisement products such as real time bidding from third-party advertisers When you close your browser
Name of Cookie Provider Purpose Expires
__hstc The main cookie for tracking visitors. It contains the domain, utk (see below), initial timestamp (first visit), last timestamp (last visit), current timestamp (this visit), and session number (increments for each subsequent session). 2 years
hubspotutk This cookie is used for to keep track of a visitor's identity. This cookie is passed to HubSpot on form submission and used when de-duplicating contacts. 10 years
__hssc This cookie keeps track of sessions. This is used to determine if we should increment the session number and timestamps in the __hstc cookie. It contains the domain, viewCount (increments each pageView in a session), and session start timestamp. 30 min
__hssrc Whenever HubSpot changes the session cookie, this cookie is also set. We set it to 1 and use it to determine if the visitor has restarted their browser. If this cookie does not exist when we manage cookies, we assume it is a new session. session
messagesUtk This cookie is used to recognize visitors who chat with you via the messages tool. If the visitor leaves your site before they're added as a contact, they will have this cookie associated with their browser. If you have a history of chatting with a visitor and they return to your site later in the same cookied browser, the messages tool will load your conversation history with that visitor. session
Name of Cookie Provider Purpose Expires
ci_session Preserves users states across page requests. When you close your browser
refersion_csrf_code Sets csrf token to prevent cross site request forgery. When you close your browser
__cfduid Used by the content network, Cloudflare, to identify trusted web traffic. 1 year
Google AdWords
Name of Cookie Provider Purpose Expires
ads/ga-audiences Used by Google AdWords to re-engage visitors that are likely to convert to customers based on the visitor's online behaviour across websites. When you close your browser
Name of Cookie Provider Purpose Expires
Fomo.hstry-count-since-first-event- Used by Fomo for showing user notifications. Persistent
Fomo.hstry-first-timestamp- Used by Fomo for showing user notifications Persistent
Fomo.snv- Used by Fomo for showing user notifications Persistent

5. Consent and Control

(Keep section 5.1 and 5.2 if you are using our cookie opt-in mechanism from School Privacy settings.)
  • 5.1 Before Cookies are placed on your computer or device, you will be shown a banner requesting your consent to set those Cookies. By giving your consent to the placing of Cookies you are enabling Us to provide the best possible experience and service to you. You may, if you wish, deny consent to the placing of Cookies unless those Cookies are strictly necessary; however certain features of Our Site may not function fully or as intended. You will be given the opportunity to allow and/or deny different categories of Cookie that We use.
  • 5.2 In addition to the controls that We provide, you can choose to enable or disable Cookies in your internet browser. Most internet browsers also enable you to choose whether you wish to disable all Cookies or only third-party Cookies. By default, most internet browsers accept Cookies but this can be changed. For further details, please consult the help menu in your internet browser or the documentation that came with your device.
  • 5.3 The links below provide instructions on how to control Cookies in all mainstream browsers:
  • 5.3.1 Google Chrome
  • 5.3.2 Microsoft Internet Explorer
  • 5.3.3 Microsoft Edge (Please note that there are no specific instructions at this time, but Microsoft support will be able to assist)
  • 5.3.4 Safari (macOS)
  • 5.3.5 Safari (iOS)
  • 5.3.6 Mozilla Firefox
  • 5.3.7 Android (Please refer to your device’s documentation for manufacturers’ own browsers)

6. Changes to this Cookie Policy

  • 6.1 We may alter this Cookie Policy at any time. Any such changes will become binding on you on your first use of Our Site after the changes have been made. You are therefore advised to check this page from time to time.
  • 6.2 In the event of any conflict between the current version of this Cookie Policy and any previous version(s), the provisions current and in effect shall prevail unless it is expressly stated otherwise.

7. Further Information

  • 7.1 If you would like to know more about how We use Cookies, please contact Us at
  • 7.2 For more information about privacy, data protection and our terms and conditions, please visit the following: